2.80 Rating by CuteStat

kbsmaintenance.com is 1 decade 9 years old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, kbsmaintenance.com is SAFE to browse.

PageSpeed Score
68
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.185.108.139

Hosted Country:

United States of America US

Location Latitude:

29.8284

Location Longitude:

-95.4696
Accueil - KBS Maintenance

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 3
H3 Headings: 8 H4 Headings: 3
H5 Headings: 3 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 37
Google Adsense: Not Applicable Google Analytics: UA-68824276-32

Websites Hosted on Same IP (i.e. 192.185.108.139)

Trick Photography Ideas

- trickphotographyideas.net

how to do trick photography and special effects review

Not Applicable $ 8.95

Trick Photography And Special Effects 2nd Edition Pdf

- trickphotographyandspecialeffectsreview.net

how to do trick photography and special effects

Not Applicable $ 8.95

Trick Photography

- trickphotographyspecialeffects.org

trick photography techniques how to shoot trick photos

Not Applicable $ 8.95

Trick Photography And Special Effects 2nd Edition Pdf

- trickphotographyandspecialeffectspdf.net

how to do trick photography and special effects

Not Applicable $ 8.95

Fundación Instituto Hipólito Unanue

- fihu-diagnostico.org.pe
1,357,204 $ 480.00

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.12.0
Date: Sat, 10 Jun 2017 18:56:45 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 12214
Connection: keep-alive
Vary: Accept-Encoding,User-Agent
Last-Modified: Sat, 10 Jun 2017 08:15:55 GMT
Accept-Ranges: bytes
Cache-Control: max-age=0
Expires: Sat, 10 Jun 2017 18:56:45 GMT
Content-Encoding: gzip

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Aug 10, 2004, 12:00 AM 1 decade 9 years 10 months ago
Last Modified: Jun 5, 2017, 12:00 AM 7 years 1 week 1 day ago
Expiration Date: Aug 10, 2017, 12:00 AM 6 years 10 months 5 days ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1509.websitewelcome.com 192.185.108.133 United States of America United States of America
ns1510.websitewelcome.com 192.185.108.134 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
kbsmaintenance.com A 14392 IP: 192.185.108.139
kbsmaintenance.com NS 86399 Target: ns1510.websitewelcome.com
kbsmaintenance.com NS 86399 Target: ns1509.websitewelcome.com
kbsmaintenance.com SOA 86399 MNAME: ns1509.websitewelcome.com
RNAME: info.omnivisiondesign.com
Serial: 2017060503
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
kbsmaintenance.com MX 14399 Target: mail.kbsmaintenance.com
kbsmaintenance.com TXT 14399 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Domain Name: kbsmaintenance.com
Registrar URL: http://www.godaddy.com
Registrant Name: Bill Papageorgiou
Registrant Organization: KBS Maintenance
Name Server: NS1509.WEBSITEWELCOME.COM
Name Server: NS1510.WEBSITEWELCOME.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=kbsmaintenance.com

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.